Gene detail [Fasta]
Species | Megaselia scalaris |
---|---|
Gene | MESCA000768 |
Position | scaffold28608:3..499[GBrowse] |
sequence |
mRNA: >MESCA000768-RA ATGAACATTCAATTTATCTTTACGAAATTGGAACATTTTTTGAAAATTCCAGGAAACTCAAAGTGCTGTGATTGTCGAGGPEP: >MESCA000768-PA MNIQFIFTKLEHFLKIPGNSKCCDCRGSDPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENIKVMMELGN |
Swiss-Prot | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 |
KEGG | K12489 ACAP; Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF57863 ArfGap/RecO-like zinc finger superfamily |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00105 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00405 |
You might be interested in these researchers

You might be interested in these references
