Gene detail [Fasta]
Species | Megaselia scalaris |
---|---|
Gene | MESCA007671 |
Position | scaffold10905:446..697[GBrowse] |
sequence |
mRNA: >MESCA007671-RA GATAAAAAATACCAAAAGTTAACTAAAAAATACCTGAAAATGGACGCCATGTCATCGAATTTGCAACAACAACGAGCTTTPEP: >MESCA007671-PA MDAMSSNLQQQRALVEQLKREASIAREPISESCAKLLKYINEHEQEDFLLTGFSSQKVNPFREKSSCTVL |
Swiss-Prot | Guanine nucleotide-binding protein subunit gamma-1 |
SUPERFAMILY | SSF48670 Transducin (heterotrimeric G protein), gamma chain superfamily |
Gene3D | G3DSA:4.10.260.10 |
Pfam | PF00631 G-gamma; GGL domain |
SMART | SM00224 |
ProSiteProfiles | PS50058 G_PROTEIN_GAMMA; G-protein gamma subunit domain profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
