Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Danaus plexippus
GeneDPOGS203882
PositionDPSCF300402:13293..30126[GBrowse]
MonarchBasehttp://monarchbase.umassmed.edu/tools3/Get_gene.cgi?id=DPOGS203882
sequence mRNA:
>DPOGS203882-TA
ATGGATTCAGGACCAGCTCAAGAAATTACTGAGCTTCTTAAACAATGGGAAGAACAGCACACGTCTTCAAACTACGATCC
TATTCCGACACTGACAAGGATAGCGGAGATTATAGAGGCAGAGACGGAGAATTTCATGAAGAAGGACCCGGACCCCTTTG
ATGAGAGGCATCCGTCCCGGACCGACCCGGAGTGTGCCCTCGGACATGCACTCAAAGTTATGTTTAAAAAAGATAATTTT
ATGACTAAGCTAGTAAACGACTATCTTCGTGACACGTACTACTCCCGTCAGAACATAACGGGTCAAGATGTACACAAACT
GAACGTAGCGGCCTGCAGGTTGACCCTTGACCTCATGCCCGGCCTAGAGATGAGTGTCGTTTTTCAGGACAATGAAGCCC
TCATCCATCGCCTGGTGAACTGGGCGACCAACTCGTCGGAACCCCTGCAGTGCTACGCCACAGGACTCCTGGCTGCGGCG
ATGGAAGTCCAGGAAATTGCGACCAATTTTAGAGATCTTAATGCAATGCTGGTGCCGCTGATGCTGAAGAGGCTACACGA
CCTTAGAAATAAGTCCCTCGAAGAAAAACCAAGCCAGAACCTGGTGACTCCGCCGAACCAGACGCGGCATTTCGCCAGGT
TTGACAGGAAGAGGAACACAGATAGCGGTAAGACGAGCAATGGACCCACGCCGGAAAAGAAAGAACGAAATAACGTTAAA
CAGACTATAGATGGCGCTGATAGTTTGCTAACATATATATATATATATATAGCGTTGTATGCTGTATGTTCCAGGTGGTG
GCGAGTCCCCCCGCTGGCGCCTCATGTCCCCCCCGCGAGGCCCCCCGCACCCCCCACCCTCCACGAAACGTCCAGCAATT
CCAGTTGGGTTGAAATGGAAACTTATGTTATAGGTAACATACAAATCCACCCGCCGACTGACGCGACCAAACAGATGCTT
ATATTAAGATATCTGACGCCGATGGGAGATGGAATATTCCTGTCACACGTCTTCGAGAAGAATGCACTGGGCCTAATCCT
CGGATATCTGAACGTGAGAGAGTCCAGGGACTCGAGGCTGGCTTTCGAGGCGCTCAAGTACCTGGCTGCCCTGCTGTGCC
ACAAGAAGTTCTCAATAGACTTCATCAACATGGGCGGGTTACAGAAGTTCCTAGAAGTGCCGCGGCCATCGGTGGCTGCG
ACCGGCGTGTCCATCTGTCTGTACTACTTGGCGTACTGTGAGGACGCTATGGAGAGAGTTTGTCTCATGCCGAGACACAT
ATTAGCTGATCTTGTGAAATATGCGTTATGGCTGTTGGAGTGCTCCCATGACTCGGGCCGGTGTCATGCCACCATGTTCT
TCGGGCTGTCATTCCAGTTCAGAGTCATTCTCGAAGAGTTTGATAATCAGGATGGACTCCGGAAGCTATACAACGTCATA
TCAACTTTGCCCATACTCGGCTCGGACGAGGAGGAGGCGCGCGTGTCCGACGACGAGACGTGTGCGGCACGACAGATCGT
ACGACACGTGTGCGTAGCGCTCAGGAGATACTTCGAAGCCCACCTACGTATCAGGGCGGTTCAGGTCGCTATGCGTGTGT
GTGTTACAGGTGACTATGCCTATGTACGCGCGAAGTATGTATTTGCGTCCAAGTCGTCTCCAGAGGAGCTGCAGGAACAG
CTGGAGGCGGTGCAGGCGGCGGGCGTGTGCCGCTGGCCGCCCTGCGACGAGCTGCGGGACCTGGGCGGCGTCACGCTGCT
GTTGCAGGTGGTGGGCTACGCTTACGAGTGGAACTTCAACGGACGCGCGGAGACGGTGCGGTCGGCGCTGGACGTGGTGT
CCATGTGCTGCGTGTCGCCCAGGGTGCAGCTGCTGTTGACGGAGAAGATCGACATGAGAGACGCGGACCTCACCACCGGC
GTCCATATAGTGCTGGAGAAACTCAGAGGGGCGCTACCGGATCTGAATTCCAGGCAGAACGGTGCTGCCGACGGCGACAT
AGTGCCGGAACCGGAAGTACAAAAGGCGGCCCTGAACGTCCTGGTGAACTGTGTCTGTGCCCCGGTACACAGGGCAGGTC
CGTCAACGAACCGCATGTCGGTGACCGGCTCCACCAGGAAGAAGACGGCCGCCAAGTCCTACGAGGACGTGATCCAGAAG
GTGTGGGAGAGCGTGAGGACCAACAACGGCATCATGGTGTTGTTGTCTCTGATGATGGTGAAGTCCCCGATAACGGACGC
GGACCGTCTCCGAGGCCTGGCGTGCAGGGCGCTGGCCGGACTGGCGCGCTGCCCCACCGTCAGGCAGATCATATCCAAGC
TGCCGCTCTTCACCACCTCGCATCTGCAAGTGTTAATGCGTGATCCCATACTACAAGAAAAACGGCAGGAGCACGTGATG
TTCCAGAAATACGCTCTGGAACTGCTGGAGAGGGTTTCCGGCAAGAGCAAACACATGGGAGCCGACTTCGAGACGTCGCT
GGCGAACATACACAGGGCGAACGTAGTGGCCCAAACACGCATCACGTACAACGAGCGTCAGCTGCTACAGTTGGTGGCGT
CGCACCTGTGGAACCGGGGGCTCCGGGAGGCCGCGGGGGTGCTCCAGCGGGAGGCCCGCCTGCCGCCGCTCGCGGCCCCC
GCGGTGCCCCCCACTCCGCCCCCACCACCCGTCTACACGCCGTCAACGCCTATCAGGGCGCGCCTGTCCGTGTCGCGAAC
CAGCAGCTGCGGCTCGATGCACCGCGACGTGGAGCACCCGCACACACACGCCACCACACACACAGACGACAGCCCCGCGC
CCGCCGTCATAAAACTCAGGAAAGTGCAGGTCGTCCACGCGCCCACGACGCCCACGTCCGAACACAAGCGCTCGCTACAG
AAGCAGCTGACGATGGGCGGCGGCGAGCGCGCGCCGTCCCCGCCGCGGGTCACGCTCCACTCCATCATCACGGAGTACCT
TTACAACCAGCACGCGCTGTGCAAGAACCCCGTCGTTACTTGCCCGCAGTTTAATTTACTTGAGCCTCACAAGTGTCCGG
AGCCGTCTCCTCAGTCCCTGGTGTCGTGGTCTCGCCACGAGCAGGCCAACCTGGTGTCCCGCTTGGTGCGGCGCGAACTG
GGCGCCACCTCGACGCGCGCCCACGCCAGACTTGCGCATGCGCACTTCGCGCACGTGCGCACGCTCCGCCTCCAGGACGA
CGACGCCTACTTCACACACACTATATTCCATCCGACGCAGCAGCAGCTGCTGACGGCGACGTCTTCCGGCGACATCCGGA
TATTCAACCTGTTCACCGGCGTCGAGGAGAACTCCTACCAGGTCCACGAGTCCTACATTTACCACATGCAGGCGAGTAGA
GACGGCTCGCTGCTGCTGGCGTCCTCCACCACCTCCTGGCGGACTCTCTCCGCGCTCTGGAACATGAAGGAGTTTGAGCA
GTTATTTCAATTAGACAACGAGGAGTACGTGGAGTTCTCCAAGATGTCTGACGATAGGATCATAGGCACCAAGGGCGAGA
CGGCCAGCATATTCGACACGAGGACCGGCCTGGAGGTGATGACCCTCACGCCGGCTATATCCAACCAGTACGCCAAGAAC
AGGGCGACCTTCAACCCCACGGACGAACTGGTGCTATCCGATGGCGTGCTCTGGGACGTGAACACAGGCAAGGAGATACA
CAAGTTCGACAAATTGAATCAGACCCACAGCGGAGTGTTCCACCCCAACGGCCTGGAGGTGATATCAAACACTGAAGTGT
GGGATCTGAGAACCTTTCATCTACTGAGAACCGTGCCGTCCTTGGACAAGTCAGAGGTGATGTTCAGTCCGTCCTGCGGC
GTGTTGTACGCGGTTTGCTCCGACCAGGACTCGGAGGAGAGGAGCCAGTTCGACACCAGCTTCAAAACCCTGGACCCCTA
CGACTACTCCAGCATAGCAACGATCGACGTGAAACGTAACATCTACTCGCTGGGCGTGTCGCGCTACGGGACACAGATAG
CGCTCGTCGAGAACATGGGGGACTTCGAGCAGGTGCAGGAGTCCTGCGTGAAGCTGTACGACGTGGGCAGGAAGAGGGAC
CACGACGACGACGCGGAGGAGGAGGAGGAAGACGAGCTCGCTGGAGGCTCCGAGAACGATGATGGATCAGACTCGGGCTC
GGACAACGATGATGACTGTTAG
PEP:
>DPOGS203882-PA
MDSGPAQEITELLKQWEEQHTSSNYDPIPTLTRIAEIIEAETENFMKKDPDPFDERHPSRTDPECALGHALKVMFKKDNF
MTKLVNDYLRDTYYSRQNITGQDVHKLNVAACRLTLDLMPGLEMSVVFQDNEALIHRLVNWATNSSEPLQCYATGLLAAA
MEVQEIATNFRDLNAMLVPLMLKRLHDLRNKSLEEKPSQNLVTPPNQTRHFARFDRKRNTDSGKTSNGPTPEKKERNNVK
QTIDGADSLLTYIYIYIALYAVCSRWWRVPPLAPHVPPARPPAPPTLHETSSNSSWVEMETYVIGNIQIHPPTDATKQML
ILRYLTPMGDGIFLSHVFEKNALGLILGYLNVRESRDSRLAFEALKYLAALLCHKKFSIDFINMGGLQKFLEVPRPSVAA
TGVSICLYYLAYCEDAMERVCLMPRHILADLVKYALWLLECSHDSGRCHATMFFGLSFQFRVILEEFDNQDGLRKLYNVI
STLPILGSDEEEARVSDDETCAARQIVRHVCVALRRYFEAHLRIRAVQVAMRVCVTGDYAYVRAKYVFASKSSPEELQEQ
LEAVQAAGVCRWPPCDELRDLGGVTLLLQVVGYAYEWNFNGRAETVRSALDVVSMCCVSPRVQLLLTEKIDMRDADLTTG
VHIVLEKLRGALPDLNSRQNGAADGDIVPEPEVQKAALNVLVNCVCAPVHRAGPSTNRMSVTGSTRKKTAAKSYEDVIQK
VWESVRTNNGIMVLLSLMMVKSPITDADRLRGLACRALAGLARCPTVRQIISKLPLFTTSHLQVLMRDPILQEKRQEHVM
FQKYALELLERVSGKSKHMGADFETSLANIHRANVVAQTRITYNERQLLQLVASHLWNRGLREAAGVLQREARLPPLAAP
AVPPTPPPPPVYTPSTPIRARLSVSRTSSCGSMHRDVEHPHTHATTHTDDSPAPAVIKLRKVQVVHAPTTPTSEHKRSLQ
KQLTMGGGERAPSPPRVTLHSIITEYLYNQHALCKNPVVTCPQFNLLEPHKCPEPSPQSLVSWSRHEQANLVSRLVRREL
GATSTRAHARLAHAHFAHVRTLRLQDDDAYFTHTIFHPTQQQLLTATSSGDIRIFNLFTGVEENSYQVHESYIYHMQASR
DGSLLLASSTTSWRTLSALWNMKEFEQLFQLDNEEYVEFSKMSDDRIIGTKGETASIFDTRTGLEVMTLTPAISNQYAKN
RATFNPTDELVLSDGVLWDVNTGKEIHKFDKLNQTHSGVFHPNGLEVISNTEVWDLRTFHLLRTVPSLDKSEVMFSPSCG
VLYAVCSDQDSEERSQFDTSFKTLDPYDYSSIATIDVKRNIYSLGVSRYGTQIALVENMGDFEQVQESCVKLYDVGRKRD
HDDDAEEEEEDELAGGSENDDGSDSGSDNDDDC
Swiss-ProtProtein mahjong
KEGG     K11789     
SUPERFAMILYSSF50978  WD40 repeat-like superfamily     
Gene3DG3DSA:1.25.10.10     
ProSiteProfilesPS50896  LISH; LIS1 homology (LisH) motif profile.     
OrthologiGroup-00024    Protein VPRBP      

You might be interested in these researchers

You might be interested in these references