Gene detail [Fasta]
Species | Dendroctonus ponderosae |
---|---|
Gene | DPO007123 |
Position | Seq_1096313:1841..2218[GBrowse] |
sequence |
mRNA: >DPO007123-RA TATTGGCCATTAGGCCCCTTGATTTGCGATACGTGGCTGGCTCTAGACTACCTTGCTAGCAATGCTTCCGTGTTGAATCTPEP: >DPO007123-PA YWPLGPLICDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTNRKAASMIGCAWGVSLLLWPPWIYSWPYIEG |
Swiss-Prot | Muscarinic acetylcholine receptor DM1 |
SUPERFAMILY | SSF81321 Family A G protein-coupled receptor-like superfamily |
Gene3D | G3DSA:1.20.1070.10 |
Pfam | PF00001 7tm_1; 7 transmembrane receptor (rhodopsin family) |
ProSiteProfiles | PS50262 G_PROTEIN_RECEP_F1_2; G-protein coupled receptors family 1 profile. |
PRINTS | PR00243 |
ProSitePatterns | PS00237 G_PROTEIN_RECEP_F1_1; G-protein coupled receptors family 1 signature. |
You might be interested in these researchers

You might be interested in these references
