Gene detail [Fasta]
Species | Dendroctonus ponderosae |
---|---|
Gene | DPO005786 |
Position | Seq_1102902:337045..338158[GBrowse] |
sequence |
mRNA: >DPO005786-RA ATGCTCCAACTGTCCACGCAACTACAAGCACCGACAACAGTTCGTCCGCCATTTGAGGTACGAATGTGGCAAAACTCCTAPEP: >DPO005786-PA MLQLSTQLQAPTTVRPPFEVRMWQNSYGELPLLSHQVLPQVPLEAAHQKVRFKCSNCPRSYKHRKHLTHHLKYQCGKTPT |
Swiss-Prot | Longitudinals lacking protein, isoforms A/B/D/L |
Pfam | PF00096 zf-C2H2; Zinc finger, C2H2 type |
SMART | SM00355 |
ProSiteProfiles | PS50157 ZINC_FINGER_C2H2_2; Zinc finger C2H2 type domain profile. |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
You might be interested in these researchers

You might be interested in these references
