Gene detail [Fasta]
Species | Musca domestica |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011296456.1 |
sequence |
PEP: >XP_011296456.1 MTFITNNSKKYGDMYRVWILQQLAVFSSDPRDLEVILSSPQHITKNNLYELLHQWLGTGLLMSSGKKWHSRRKIITPTFH |
Swiss-Prot | Cytochrome P450 4d2 |
KEGG | K15639 CYP734A1, BAS1; PHYB activation tagged suppressor 1 [EC:1.14.-.-] |
SUPERFAMILY | SSF48264 Cytochrome P450 superfamily |
Gene3D | G3DSA:1.10.630.10 |
Pfam | PF00067 p450; Cytochrome P450 |
PRINTS | PR00463 |
ProSitePatterns | PS00086 CYTOCHROME_P450; Cytochrome P450 cysteine heme-iron ligand signature. |
PANTHER | PTHR24290:SF65 |
You might be interested in these researchers

You might be interested in these references
