Gene detail [Fasta]
| Species | Musca domestica |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011295214.1 |
| sequence |
PEP: >XP_011295214.1 MAWISQGPFRKKILNVNEFPTARNYGGRSPFSRSHVIYIFVVLCVLQQMIPNVEARGPCNEDQFACKDGRCISKTKMCDG |
| Swiss-Prot | Putative vitellogenin receptor |
| SUPERFAMILY | SSF57424 LDL receptor-like module superfamily |
| Gene3D | G3DSA:4.10.400.10 |
| Pfam | PF00057 Ldl_recept_a; Low-density lipoprotein receptor domain class A |
| SMART | SM00192 |
| ProSiteProfiles | PS50068 LDLRA_2; LDL-receptor class A (LDLRA) domain profile. |
| PRINTS | PR00261 |
| ProSitePatterns | PS01209 LDLRA_1; LDL-receptor class A (LDLRA) domain signature. |
| PANTHER | PTHR10529 |
You might be interested in these researchers
You might be interested in these references
