Gene detail [Fasta]
Species | Musca domestica |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011292580.1 |
sequence |
PEP: >XP_011292580.1 MADLMRLGNVDVVIQKDKLGSPIGGSDDGNLAAFGAGINNFGGGSGGGGGGGVGFDMGDLQQELDQDEFDGMNLTNGERP |
Swiss-Prot | Ras GTPase-activating protein 1 |
KEGG | K04352 RASA1, RASGAP; Ras GTPase-activating protein 1 |
SUPERFAMILY | SSF49562 C2 domain (Calcium/lipid-binding domain, CaLB) superfamily |
Gene3D | G3DSA:1.10.506.10 |
Pfam | PF00018 SH3_1; SH3 domain |
SMART | SM00252 |
ProSiteProfiles | PS50018 RAS_GTPASE_ACTIV_2; Ras GTPase-activating proteins profile. |
PRINTS | PR00401 |
PANTHER | PTHR10194:SF19 |
You might be interested in these researchers

You might be interested in these references
