Gene detail [Fasta]
| Species | Musca domestica |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011292573.1 |
| sequence |
PEP: >XP_011292573.1 MIIAGVKIQLPATTTYRYKSPFRPVKKGRGLTGLKNLGNTCYMNSILQCLSNTPQLAEYCITDKYKNYISRNNKTKGQIV |
| Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 8 |
| KEGG | K11839 USP8, UBP5; ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12] |
| SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
| Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
| ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
| ProSitePatterns | PS00972 USP_1; Ubiquitin specific protease (USP) domain signature 1. |
| PANTHER | PTHR24006 |
You might be interested in these researchers
You might be interested in these references
