Gene detail [Fasta]
| Species | Musca domestica |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_005191555.1 |
| sequence |
PEP: >XP_005191555.1 MPMQPIKFYYDVLNQSSRALYILLEASKIPFEPVQISLLKGEHLTGEYRDKVTRFKRIPAINDHGFQLSESVAIFRHLVR |
| Swiss-Prot | Glutathione S-transferase theta-1 |
| KEGG | K00799 GST, gst; glutathione S-transferase [EC:2.5.1.18] |
| SUPERFAMILY | SSF52833 Thioredoxin-like superfamily |
| Gene3D | G3DSA:1.20.1050.10 |
| Pfam | PF00043 GST_C; Glutathione S-transferase, C-terminal domain |
| ProSiteProfiles | PS50404 GST_NTER; Soluble glutathione S-transferase N-terminal domain profile. |
| Coils | Coil |
| PANTHER | PTHR11260 |
You might be interested in these researchers
You might be interested in these references
