Gene detail [Fasta]
Species | Musca domestica |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_005190097.1 |
sequence |
PEP: >XP_005190097.1 MSSLPLLLNLANDLNRLSLAVSPFYDLPSTHRHPYYMALVDGDAPRRQENAGAVSAIGKDGFQVCMDVQQFKPSELNVKV |
Swiss-Prot | Heat shock protein 23 |
KEGG | K04455 HSPB1; heat shock protein beta-1 |
SUPERFAMILY | SSF49764 HSP20-like chaperones superfamily |
Gene3D | G3DSA:2.60.40.790 |
Pfam | PF00011 HSP20; Hsp20/alpha crystallin family |
ProSiteProfiles | PS01031 HSP20; Heat shock hsp20 proteins family profile. |
PRINTS | PR00299 |
PANTHER | PTHR11527:SF42 |
You might be interested in these researchers

You might be interested in these references
