Gene detail [Fasta]
| Species | Musca domestica |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_005186673.1 |
| sequence |
PEP: >XP_005186673.1 MGDVQMLMEMGFPKERAEYALKVTNNKGVEPAMEWLLAHVDEPIPQQPAVEEAPSTSNSEKVAGEAKSLKCDDCGKLCKD |
| Swiss-Prot | UBX domain-containing protein 1 |
| SUPERFAMILY | SSF46934 UBA-like superfamily |
| Gene3D | G3DSA:1.10.8.10 |
| Pfam | PF00627 UBA; UBA/TS-N domain |
| SMART | SM00165 |
| ProSiteProfiles | PS50033 UBX; UBX domain profile. |
| Coils | Coil |
| ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
| PANTHER | PTHR13020:SF25 |
You might be interested in these researchers
You might be interested in these references
