Gene detail [Fasta]
Species | Musca domestica |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_005184248.1 |
sequence |
PEP: >XP_005184248.1 MNFENEDRLQFEQLTGGNIIEKPPIYGNTGEHLLFLSGKYINVYSTISGQLVRKLEGASTTLVDYCYELDNEDIVVACSQ |
Swiss-Prot | WD repeat-containing protein 75 |
KEGG | K14552 NAN1, UTP17, WDR75; NET1-associated nuclear protein 1 (U3 small nucleolar RNA-associated protein 17) |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00320 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
Coils | Coil |
PANTHER | PTHR22847:SF385 |
You might be interested in these researchers

You might be interested in these references
