Gene detail [Fasta]
Species | Musca domestica |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_005179882.1 |
sequence |
PEP: >XP_005179882.1 MKMLPVQLSLNPPLGLWSDMLWRCPPAQPSQLAELKTQLPPSLPSDPRLWSREDVAVFLHFCEREFDLPKVDYDLFQMNG |
Swiss-Prot | Ets DNA-binding protein pokkuri |
KEGG | K03211 ETV6_7, yan; ETS translocation variant 6/7 |
SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
Gene3D | G3DSA:1.10.10.10 |
Pfam | PF02198 SAM_PNT; Sterile alpha motif (SAM)/Pointed domain |
SMART | SM00251 |
ProSiteProfiles | PS51433 PNT; Pointed (PNT) domain profile. |
PRINTS | PR00454 |
ProSitePatterns | PS00346 ETS_DOMAIN_2; Ets-domain signature 2. |
PANTHER | PTHR11849:SF179 |
You might be interested in these researchers

You might be interested in these references
