Gene detail [Fasta]
| Species | Musca domestica |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/NP_001273808.1 |
| sequence |
PEP: >NP_001273808.1 MAEIKVEFAVQMTGEQWENNIRNALSGMGKLEVDNQQGRIIVHTKEPWYMLQEKIEASGCKAVLAGFGGQSAVSIINTTG |
| Swiss-Prot | Copper chaperone for superoxide dismutase |
| KEGG | K04569 CCS; copper chaperone for superoxide dismutase |
| SUPERFAMILY | SSF49329 Cu,Zn superoxide dismutase-like superfamily |
| Gene3D | G3DSA:2.60.40.200 |
| Pfam | PF00080 Sod_Cu; Copper/zinc superoxide dismutase (SODC) |
| PRINTS | PR00068 |
| ProSitePatterns | PS00332 SOD_CU_ZN_2; Copper/Zinc superoxide dismutase signature 2. |
| PANTHER | PTHR10003 |
You might be interested in these researchers
You might be interested in these references
