Gene detail [Fasta]
| Species | Anopheles sinensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KFB48404.1 |
| sequence |
PEP: >KFB48404.1 MKLIVLVLAVSCMASFGTAETAPKYGVKPSPYKPSAPAPPAPGGSDIDKCGCHQIVAKLKKVESNLLKLILNLRNKYGAI |
| Swiss-Prot | Fibrinogen C domain-containing protein 1 |
| SUPERFAMILY | SSF56496 Fibrinogen C-terminal domain-like superfamily |
| Gene3D | G3DSA:4.10.530.10 |
| Pfam | PF00147 Fibrinogen_C; Fibrinogen beta and gamma chains, C-terminal globular domain |
| SMART | SM00186 |
| ProSiteProfiles | PS51406 FIBRINOGEN_C_2; Fibrinogen C-terminal domain profile. |
| ProSitePatterns | PS00514 FIBRINOGEN_C_1; Fibrinogen C-terminal domain signature. |
| PANTHER | PTHR19143 |
You might be interested in these researchers
You might be interested in these references
