Gene detail [Fasta]
| Species | Anopheles sinensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KFB47609.1 |
| sequence |
PEP: >KFB47609.1 MPKENETNVSANSELIIPQMKRIKRNDLTFGRQLGEGEYGVVLMAEAKNILPNERSTTVAIKMMRYSDDDTIKKAMLAEL |
| Swiss-Prot | Tyrosine-protein kinase transforming protein kit |
| KEGG | K05091 KIT, SCFR; proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1] |
| SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
| Gene3D | G3DSA:3.30.200.20 |
| Pfam | PF07714 Pkinase_Tyr; Protein tyrosine kinase |
| ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
| PRINTS | PR00109 |
| ProSitePatterns | PS00109 PROTEIN_KINASE_TYR; Tyrosine protein kinases specific active-site signature. |
| PANTHER | PTHR24416:SF298 |
You might be interested in these researchers
You might be interested in these references
