Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012161176.1 |
sequence |
PEP: >XP_012161176.1 MASIEERFNAAVNVIKGLPKNGPYQPSTAMMLKFYGYYKQATEGPCHQKRPGFWDVVGKAKWDAWNDNRHLTKQQAMERY |
Swiss-Prot | Acyl-CoA-binding domain-containing protein 5 |
SUPERFAMILY | SSF47027 Acyl-CoA binding protein superfamily |
Gene3D | G3DSA:1.20.80.10 |
Pfam | PF00887 ACBP; Acyl CoA binding protein |
ProSiteProfiles | PS51228 ACB_2; Acyl-CoA-binding (ACB) domain profile. |
PRINTS | PR00689 |
Coils | Coil |
ProSitePatterns | PS00880 ACB_1; Acyl-CoA-binding (ACB) domain signature. |
PANTHER | PTHR23310:SF14 |
You might be interested in these researchers

You might be interested in these references
