Gene detail [Fasta]
Species | Anopheles sinensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/KFB46640.1 |
sequence |
PEP: >KFB46640.1 MSDIQTLMDMGFPKEKAERALEVTNHKGVEQAMEWLLAHADEPLPPASGAGGDNPSAGGESAPESSSSTAEDTPVAKSLK |
Swiss-Prot | UBX domain-containing protein 1-A |
SUPERFAMILY | SSF46934 UBA-like superfamily |
Gene3D | G3DSA:1.10.8.10 |
Pfam | PF00789 UBX; UBX domain |
SMART | SM00166 |
ProSiteProfiles | PS50030 UBA; Ubiquitin-associated domain (UBA) profile. |
Coils | Coil |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
PANTHER | PTHR13020:SF25 |
You might be interested in these researchers

You might be interested in these references
