Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012160487.1 |
| sequence |
PEP: >XP_012160487.1 MHAFSGFNGFGQFGGGSQQSVNEFIEFSLENTPNDQEHILLLAASWSYTAYARGKYLVLRGFLTGTPNTSICLQAPGNIN |
| Swiss-Prot | RCC1 domain-containing protein 1 |
| SUPERFAMILY | SSF50985 RCC1/BLIP-II superfamily |
| Gene3D | G3DSA:2.130.10.30 |
| Pfam | PF00415 RCC1; Regulator of chromosome condensation (RCC1) repeat |
| ProSiteProfiles | PS50012 RCC1_3; Regulator of chromosome condensation (RCC1) repeat profile. |
| PRINTS | PR00633 |
| ProSitePatterns | PS00626 RCC1_2; Regulator of chromosome condensation (RCC1) signature 2. |
| PANTHER | PTHR22870 |
You might be interested in these researchers
You might be interested in these references
