Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012158686.1 |
| sequence |
PEP: >XP_012158686.1 MADKGKEAPKNAEQKNQVTRAMPEQSNDYRVVVFGAGGVGKSSLVLRFIRGTFRETYIPTIEDTYRQVISCNKNICTLQI |
| Swiss-Prot | GTP-binding protein Di-Ras2 |
| KEGG | K07841 |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF00071 Ras; Ras family |
| SMART | SM00175 |
| ProSiteProfiles | PS51421 RAS; small GTPase Ras family profile. |
| PRINTS | PR00449 |
| Coils | Coil |
| TIGRFAM | TIGR00231 |
| PANTHER | PTHR24070:SF178 |
You might be interested in these researchers
You might be interested in these references
