Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012157654.1 |
sequence |
PEP: >XP_012157654.1 MDMKMEIVSQSQDMSTGSPSEVPNDPGKMFIGGLSWQTSPESLRDYFSRFGEISEAMVMKDPTTRRSRGFGFITFSDPVS |
Swiss-Prot | RNA-binding protein Musashi homolog Rbp6 |
KEGG | K14411 MSI; RNA-binding protein Musashi |
SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
Gene3D | G3DSA:3.30.70.330 |
Pfam | PF00076 RRM_1; RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
SMART | SM00360 |
ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
PANTHER | PTHR24012:SF324 |
You might be interested in these researchers

You might be interested in these references
