Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012156101.1 |
sequence |
PEP: >XP_012156101.1 MTTTTHNEYTDIELEVGSTNKTDPIYSIKPDFITQWRQKKERENICKSIFNRFVEHSECKRLLEAAQLYHPFIGDNGELN |
Swiss-Prot | Probable muscarinic acetylcholine receptor gar-2 |
KEGG | K04134 CHRMN; muscarinic acetylcholine receptor |
SUPERFAMILY | SSF81321 Family A G protein-coupled receptor-like superfamily |
Gene3D | G3DSA:1.20.1070.10 |
Pfam | PF00001 7tm_1; 7 transmembrane receptor (rhodopsin family) |
ProSiteProfiles | PS50262 G_PROTEIN_RECEP_F1_2; G-protein coupled receptors family 1 profile. |
PRINTS | PR00237 |
ProSitePatterns | PS00237 G_PROTEIN_RECEP_F1_1; G-protein coupled receptors family 1 signature. |
PANTHER | PTHR24249:SF52 |
You might be interested in these researchers

You might be interested in these references
