Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012155857.1 |
sequence |
PEP: >XP_012155857.1 MPRNGCEANGGGVSDGCAYSDELIMEQGVSFNVRYTGCVEVKTSMKLLNFETRTKVARECINRVCEAAGLKSVGKRRVDK |
Swiss-Prot | SHC-transforming protein 1 |
KEGG | K06279 SHC1; SHC- transforming protein 1 |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:3.30.505.10 |
Pfam | PF00640 PID; Phosphotyrosine interaction domain (PTB/PID) |
SMART | SM00462 |
ProSiteProfiles | PS50001 SH2; Src homology 2 (SH2) domain profile. |
PRINTS | PR00629 |
Coils | Coil |
PANTHER | PTHR10337:SF11 |
You might be interested in these researchers

You might be interested in these references
