Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012154882.1 |
sequence |
PEP: >XP_012154882.1 MADLEAVLADVSYLMAMEKSKCTPAARASKRLVLPDPSVRSVMYKYLEKENELNFHKIFNQILGYLLFKDFCENDSEEPI |
Swiss-Prot | G protein-coupled receptor kinase 1 |
KEGG | K00910 ADRBK, GRK; beta-adrenergic-receptor kinase [EC:2.7.11.15] |
SUPERFAMILY | SSF48097 Regulator of G-protein signaling, RGS superfamily |
Gene3D | G3DSA:1.10.167.10 |
Pfam | PF00615 RGS; Regulator of G protein signaling domain |
SMART | SM00220 |
ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
PRINTS | PR00717 |
ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
PANTHER | PTHR24355:SF18 |