Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004532847.1 |
sequence |
PEP: >XP_004532847.1 MSEQRYSQAKALRAPTLIGVLFLSRFDLARDNAMELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKESDAEARFK |
Swiss-Prot | Curved DNA-binding protein |
KEGG | K05516 |
SUPERFAMILY | SSF49493 HSP40/DnaJ peptide-binding domain superfamily |
Gene3D | G3DSA:1.10.287.110 |
Pfam | PF00226 DnaJ; DnaJ domain |
SMART | SM00271 |
ProSiteProfiles | PS50076 DNAJ_2; dnaJ domain profile. |
PRINTS | PR00625 |
ProSitePatterns | PS00636 DNAJ_1; Nt-dnaJ domain signature. |
Hamap | MF_01154 |
PANTHER | PTHR24076:SF90 |
You might be interested in these researchers

You might be interested in these references
