Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004532173.1 |
| sequence |
PEP: >XP_004532173.1 MTECAMKRVMLLAAAAVMLAQMGLAQADQLQDIHQRGVLRVAVPQDFPPFGSVGTDLQPRGYDIDMANYLAKSMKLKLQL |
| Swiss-Prot | ABC transporter glutamine-binding protein GlnH |
| KEGG | K02030 |
| SUPERFAMILY | SSF53850 Periplasmic binding protein-like II superfamily |
| Gene3D | G3DSA:3.40.190.10 |
| Pfam | PF00497 SBP_bac_3; Bacterial extracellular solute-binding proteins, family 3 |
| SMART | SM00062 |
| ProSitePatterns | PS01039 SBP_BACTERIAL_3; Bacterial extracellular solute-binding proteins, family 3 signature. |
| PANTHER | PTHR18966:SF149 |
You might be interested in these researchers
You might be interested in these references
