Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004530074.1 |
sequence |
PEP: >XP_004530074.1 MRSTIEFEECLKDSPRFRQFISKEETDIEHLEQRLEKIIKLCTVAVDSGKEYVKNQSAFAMSLWDLQQHFADNKNAHNAL |
Swiss-Prot | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 |
KEGG | K12489 ACAP; Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF57863 ArfGap/RecO-like zinc finger superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF12796 Ank_2; Ankyrin repeats (3 copies) |
SMART | SM00233 |
ProSiteProfiles | PS50088 ANK_REPEAT; Ankyrin repeat profile. |
PRINTS | PR00405 |
Coils | Coil |
PANTHER | PTHR23180:SF206 |
You might be interested in these researchers

You might be interested in these references
