Gene detail [Fasta]
| Species | Ceratitis capitata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004527677.1 |
| sequence |
PEP: >XP_004527677.1 MHQQEGLFTRQQPTDRFREQTDPVLQLENINVNFDGFQALTDLSLQIGVGELRCIIGPNGAGKTTLMDVITGKTRPQSGR |
| Swiss-Prot | High-affinity branched-chain amino acid transport ATP-binding protein LivG |
| KEGG | K11962 urtD; urea transport system ATP-binding protein |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF00005 ABC_tran; ABC transporter |
| ProSiteProfiles | PS50893 ABC_TRANSPORTER_2; ATP-binding cassette, ABC transporter-type domain profile. |
| TIGRFAM | TIGR03411 |
| PANTHER | PTHR24220 |
You might be interested in these researchers
You might be interested in these references
