Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004519224.1 |
sequence |
PEP: >XP_004519224.1 MATGGIDMGDLAQELDQDEFDGPNMLNGERPAIIAPPESEWYHGRLDRYSAESRLRGSGKLGSYLVRESDRKPGSYVLSY |
Swiss-Prot | Ras GTPase-activating protein 1 |
KEGG | K04352 RASA1, RASGAP; Ras GTPase-activating protein 1 |
SUPERFAMILY | SSF55550 SH2 domain superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF00616 RasGAP; GTPase-activator protein for Ras-like GTPase |
SMART | SM00323 |
ProSiteProfiles | PS50002 SH3; Src homology 3 (SH3) domain profile. |
PRINTS | PR00401 |
PANTHER | PTHR10194:SF19 |
You might be interested in these researchers

You might be interested in these references
