Gene detail [Fasta]
Species | Ceratitis capitata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_004517846.1 |
sequence |
PEP: >XP_004517846.1 MFYIYSVAFLLTAFIGNLYATPIVGGEVVYSPKYAAPKYPFIVSIQEIREAVSRSLGVHEYRHFCGGAMLNAKWFVSAAH |
Swiss-Prot | Hyaluronan-binding protein 2 |
SUPERFAMILY | SSF50494 Trypsin-like serine proteases superfamily |
Gene3D | G3DSA:2.40.10.10 |
Pfam | PF00089 Trypsin; Trypsin |
SMART | SM00020 |
ProSiteProfiles | PS50240 TRYPSIN_DOM; Serine proteases, trypsin domain profile. |
PRINTS | PR00722 |
ProSitePatterns | PS00135 TRYPSIN_SER; Serine proteases, trypsin family, serine active site. |
PANTHER | PTHR24258:SF93 |
You might be interested in these researchers

You might be interested in these references
