Gene detail [Fasta]
Species | Anopheles sinensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/KFB43324.1 |
sequence |
PEP: >KFB43324.1 MVFKCQEDSFLREFKTKVVSCEKIKGGFNVILEDTVLFPEGGGQPSDHGRVNDRLVKSVIRKGAQAVHFIEDETESAPFA |
Swiss-Prot | Alanyl-tRNA editing protein Aarsd1-A |
KEGG | K07050 |
SUPERFAMILY | SSF55186 ThrRS/AlaRS common domain superfamily |
Pfam | PF07973 tRNA_SAD; Threonyl and Alanyl tRNA synthetase second additional domain |
SMART | SM00863 |
ProSiteProfiles | PS50860 AA_TRNA_LIGASE_II_ALA; Alanyl-transfer RNA synthetases family profile. |
Coils | Coil |
PANTHER | PTHR11777:SF11 |
You might be interested in these researchers

You might be interested in these references
