Gene detail [Fasta]
Species | Anopheles sinensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/KFB41703.1 |
sequence |
PEP: >KFB41703.1 MFRPAGYDDSEEDDYDEYGYISDYKPKKINWMTELQQTEQTEDYDTMLYNAILDDNLDEVKRVLQLANDLRSGACLRQGW |
Swiss-Prot | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 |
KEGG | K18410 |
SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF12796 Ank_2; Ankyrin repeats (3 copies) |
SMART | SM00248 |
ProSiteProfiles | PS50088 ANK_REPEAT; Ankyrin repeat profile. |
PANTHER | PTHR24166:SF24 |
You might be interested in these researchers

You might be interested in these references
