Gene detail [Fasta]
| Species | Bombus terrestris |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012175736.1 |
| sequence |
PEP: >XP_012175736.1 MNGISNQCAKIKDLSIYDDEDDHKMKIKKPGPIRTVSWSESVEESNLDVPGTPRTPRTSTTPGHEKCTFHHDLELDHRPP |
| Swiss-Prot | GTP cyclohydrolase 1 |
| KEGG | K01495 GCH1, folE; GTP cyclohydrolase I [EC:3.5.4.16] |
| SUPERFAMILY | SSF55620 Tetrahydrobiopterin biosynthesis enzymes-like superfamily |
| Gene3D | G3DSA:1.10.286.10 |
| Pfam | PF01227 GTP_cyclohydroI; GTP cyclohydrolase I |
| ProSitePatterns | PS00860 GTP_CYCLOHYDROL_1_2; GTP cyclohydrolase I signature 2. |
| TIGRFAM | TIGR00063 |
| Hamap | MF_00223 |
| PANTHER | PTHR11109:SF0 |
You might be interested in these researchers
You might be interested in these references
