Gene detail [Fasta]
Species | Bombus terrestris |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012168853.1 |
sequence |
PEP: >XP_012168853.1 MNHVNDQENLKQLNLAPVQVNEVEEMDTQEGETPNDGGGDGNDTSPMNGESELACIVQDQEMEEDEARSEATFRYTVENL |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 7 |
KEGG | K11838 USP7, UBP15; ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12] |
SUPERFAMILY | SSF49599 TRAF domain-like superfamily |
Gene3D | G3DSA:2.20.210.10 |
Pfam | PF12436 USP7_ICP0_bdg; ICP0-binding domain of Ubiquitin-specific protease 7 |
SMART | SM00061 |
ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
ProSitePatterns | PS00972 USP_1; Ubiquitin specific protease (USP) domain signature 1. |
PANTHER | PTHR24006:SF89 |
You might be interested in these researchers

You might be interested in these references
