Gene detail [Fasta]
Species | Bombus terrestris |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012168523.1 |
sequence |
PEP: >XP_012168523.1 MAEETRLVRVEERLKIKIGEVKNLQSRSHGSPGARDVYCVLSLDQEEIFRTTTMERTLNPFFGEEFQFEVPRKFRYLGIY |
Swiss-Prot | Ras GTPase-activating protein 3 |
KEGG | K12380 RASA3; Ras GTPase-activating protein 3 |
SUPERFAMILY | SSF49562 C2 domain (Calcium/lipid-binding domain, CaLB) superfamily |
Gene3D | G3DSA:1.10.506.10 |
Pfam | PF00616 RasGAP; GTPase-activator protein for Ras-like GTPase |
SMART | SM00239 |
ProSiteProfiles | PS51113 ZF_BTK; Zinc finger Btk-type profile. |
Coils | Coil |
ProSitePatterns | PS00509 RAS_GTPASE_ACTIV_1; Ras GTPase-activating proteins domain signature. |
PANTHER | PTHR10194:SF53 |
You might be interested in these researchers

You might be interested in these references
