Gene detail [Fasta]
Species | Bombus terrestris |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012168168.1 |
sequence |
PEP: >XP_012168168.1 MPGLIAVSEFVEETREDYNSPTTSTFVSRMPQCRQTITSLEETLDFDRDGLTKLKKAIKAIHNSGNAHVDNEVYLGRALE |
Swiss-Prot | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 |
KEGG | K12488 ASAP; Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF48403 Ankyrin repeat superfamily |
Gene3D | G3DSA:1.20.1270.60 |
Pfam | PF12796 Ank_2; Ankyrin repeats (3 copies) |
SMART | SM00326 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00452 |
Coils | Coil |
PANTHER | PTHR23180:SF238 |