Gene detail [Fasta]
Species | Bombus terrestris |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_012164972.1 |
sequence |
PEP: >XP_012164972.1 MHDLTICWQASLRFMPPVKNQYGCGSELNVVKGETIEENDMESEPVMVPSDPSEWNSNHIASWISWCSQVFSIKPSPSTI |
Swiss-Prot | DNA-binding protein D-ETS-6 |
KEGG | K09443 |
SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
Gene3D | G3DSA:1.10.150.50 |
Pfam | PF02198 SAM_PNT; Sterile alpha motif (SAM)/Pointed domain |
SMART | SM00413 |
ProSiteProfiles | PS50061 ETS_DOMAIN_3; Ets-domain profile. |
PRINTS | PR00454 |
ProSitePatterns | PS00346 ETS_DOMAIN_2; Ets-domain signature 2. |
PANTHER | PTHR11849:SF34 |
You might be interested in these researchers

You might be interested in these references
