Gene detail [Fasta]
Species | Bombus terrestris |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_003397465.1 |
sequence |
PEP: >XP_003397465.1 MTEKIKSLFLKAKLDAKFMNAGKGHKLTESTSNDGSTSVVEPRKRVEPTEEAKVAGQAALARLEAKESNIKRFNTSYATI |
Swiss-Prot | UBX domain-containing protein 6 |
KEGG | K14011 UBXN6, UBXD1; UBX domain-containing protein 6 |
SUPERFAMILY | SSF54236 Ubiquitin-like superfamily |
Gene3D | G3DSA:3.10.20.90 |
Pfam | PF09409 PUB; PUB domain |
SMART | SM00580 |
ProSiteProfiles | PS50033 UBX; UBX domain profile. |
Coils | Coil |
PANTHER | PTHR23153:SF35 |
You might be interested in these researchers

You might be interested in these references
