Gene detail [Fasta]
| Species | Zootermopsis nevadensis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/KDR19499.1 |
| sequence |
PEP: >KDR19499.1 MNMASQDVNILAEMGFPRSKAERALEVTGNQGVEPAMEWLLAHADESLPTDPSVSSEAVNSALSQSTVEQDKQEGGSDEV |
| Swiss-Prot | UBX domain-containing protein 1 |
| SUPERFAMILY | SSF46934 UBA-like superfamily |
| Gene3D | G3DSA:1.10.8.10 |
| Pfam | PF00789 UBX; UBX domain |
| SMART | SM00166 |
| ProSiteProfiles | PS50033 UBX; UBX domain profile. |
| Coils | Coil |
| ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
| PANTHER | PTHR13020 |
You might be interested in these researchers
You might be interested in these references
