Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Aedes aegypti
GeneAAEL000276
Positionsupercont1.5:1782767..1854937[GBrowse]
VectorBasehttp://www.vectorbase.org/search/site/AAEL000276
Gene Expressionhttps://www.vectorbase.org/expression-browser/gene/AAEL000276
sequence mRNA:
>AAEL000276-RA
CTCGCAGTGAAAGCACAGAGTGTCCAATCCATTTTAGCGAGCGTGTGTTCCAAAATCAATCGTAGAATTAAAGTGCAAAA
ATATCGTGTAAAACGGTTCCAGTTCTCTGTAAAAACATTACAAATCGGAAGTTTACGCGCGGGTGATGCGTTGGAGATAG
AAAACTGTTTCCGGCCGGTGTTGGTTGAGGCGGAAAAGGTCCACAAAACAGGTGCACCGAAAGTGGAGTCTCTGGACGAG
TGATCCTCCATATCAGTGAAATCCACGACGAAAAAGCAGACCGTGAAACTCGACGAGTTGAGGTTAGGGAAGAAGCGGTG
TTCATTTTGCTTCGTGTGCTGCGAGTGAATCACAACAGCAGCTGTTCGTTTCGTCGTCGGTTTGCGAATTCGGGTGTTCA
TCCAGCGTGTTTTGTTTCGTCAGCTGCTGCGCTGTCAACGATTTTTCTGGTGTAAATATTTTGCCTCTGGGTTTTGATAA
CAGGGCGGGAGCTGTTTTGCGGTGCTCTCGTATGCTGTAACTTTCGAGGGCCGCGCTTGGAGGACTTGAAACGATATGGC
ATCACCAGCGGATCAGGCGGAAGTGCTTCGTGGGCGAGACTTGGCGCGCATCTTCCAGATATGGGAGGAAAGGCACAGCG
TTCCCGGGTACGATCCGGAGCCGGTTGTTACGAGACTAGCGGAAATCTTCGAAGAGGAGACAGAGGTTTACATGCGCAAA
GACCCGGACCCCTTCGATGAGCGACACCCATCGCGAACGGACCCGAACAGTGAACTGGGTCGCATGTTGAAGACCCTGTT
CCGGAAGGATCACTTCATGACCCGGTTGGTGAACGACTACCTTCGGGATAATTTCTTCACGCGTCAAAACATCCAGCAAT
GCTCGCAACCCCTGAATATCGCAGCCTGCCGGTTGATACTGGTGATCATGCCCGGTTTGGAAACGTCCGCCGTGTTCCAA
GCGGAATTCGATCATCTTATCACACGGCTGTACGGATGGGCCGAATCGAGCCCTGAACCTTTGCAAAGCTATGCCACTGG
GTTGTTGGGAGCTGCGATGGAAGTGCAGGAGATTGCTGTTAGCTTTCGGGAGCAGAATATTCGACTTTTACCGATCATGC
TGAGGCGGTTGCACGTGCTGCAATTGGCTCACAGAAATCGCGATCGTTTGGCGGAAGCTGGCGAGGGAATGTCCAGTACG
GCGTTCCAGCGGATGTTCCAAGGAGAGGCAGCTCTAATATCCAAGAGAAATTCCACGGAAGGTCAGAGCGAATCTGCGAT
GGTGGATGGCGCAGTGGGTGGAGAAGTCGTGGAGAGGCCCTTTGCCCATTTGGGACCATCTGAGGGAAGTGCGGTACCTC
CTAATGGTGTGTCTTCGGCGTCGAATTTGAATACGCTCTTCCAGAATGAAAACAGTCAGAATACACAGGATGCCCAAGGT
CGCCAGGCGCACCGGAACATGATCCCTATCTTTCCAGCCACGATTGCCACCAGTCAGATGCTGATCTTGCGATACCTGAC
GCCGATGGGAGAGTATCAGGAATTCCTGCCGCACGTTTTCGAACACAACGCGATGAGTTTGATCTTCCGCTACATCGAGA
ATCTGGACGCCAAGGACACCTGTCTGGCGTTCGAGGCGTTGAAGTATCTGGCATCGTTGCTGTGCCATAAGAAGTTCTCA
CTGGAGTTCATCGCGAATGGAGGTCTAGAACGGCTATTGCGAGTTCCTCGGCCTAGTTTGGCCGCCACGGGAGTTTCGAT
TGCTTTCTACTATTTGGCGTACTGTGAAGATGCAATGGAGAGGATCTGTTTGATGCCACAGAAGATCATTACGGAATTGG
TAACCTACGCGCTGTGGCTTCTGGGATGCACCCACGATTCCGGACGATGCCACGCTACGATGTTCTTCGGCCTAAGCTGC
CAGTTCAAAACAATGATGGATGAGTTCGACAAGCAGGACGGATTGCGGAAACTGTACAACGTCATCGCCGTGCTTCCGAT
CCTGATGCCAGCGGACGAATATCACCTGAACGATGACGAGGAATGTGCAGCTCGACAGGTGGTCCGACATGTTTGTGTCG
CGTTGAAGAAGTACTTTGAGAATCACCTCTACTACAAATACAATCAGGTCACGCGGCAACAGTGTCCCACGGGGACGTTG
GCACAACCGGTCTTCAAATCGGTAAAGAACTCTCCGGAAGTTATTAGCGATCAGATAAGGACGCTGCAGGAGTTGCTTCC
CATGAAGGCTCGTTGGTCACCGGTCGATGAATTTCTGGATCTGGGAGGAGTTAATTTACTGCTACGTATCATCGCATTGG
CCTACGAGTGGAACTACAGTGGACGTGGTGAGACGGTCCGCGCCGCTTTGGACGTGCTGAACGTGTGCTGCGTGATTCCT
CGAGTGCATGCCGTATTCTGCGAGCGAATCGAGTTCCCTGACGAGGGTTCCGCCGCCGGTATCAACATCGTACTGGGAGC
AGCGGAAGGCGAAATCGTAGCGGACGCAGAAGTCCAGAAATCCGCCCTGGCCGTTTTGGTGCATACGGTTTGTGCCCCTC
TGCATCGACCGAGTGGTTCTCTCGCGCGGTTTGGGTCGGCCAAGAAACGAATGCCCAATAAGAACTCGGAAGAGTTGCTG
CAGAAAGTGTGGGAGAGCGTCCGATCCAATAACGGGATCATCGTGCTGCTATCGCTGATGTGCGTTAAGACACCGATCAC
CGATGCGGATTGCATACGGGGGATGGCCTGCAGGGCGATGGCCGGTTTGGCCCGATCCGAAACAGTGCAACAGATTATCG
GGAAATTATCGCTATTTGTCAACGGGCAGCTGCAAAGTCTAATGCGCGACCCGATCCTGCAGGAGAAACGAGCCGAGCAC
GTCCAGTTCCAGAAGTACGCCCTGGAACTGCTGGAACGCGTCTCGGGCAAAGCGAAATCGGCCAACAATCAACTCGACAC
CTCACTGGCCGACATTCACAAGGCGAATGTGGTTGCCCAGACTAAGATTCAATTCAACGAGCAACAGCTGCTGGAGTTGA
TCCACCAACACCTGATGGCTCGAGGCCTGACCGAAACGGCGGCCACTCTGGTGCGGGAAGGTGGCATCACCGTTCCGAAT
CCCATCCTTCAGCAGCATCAGCAGGCGACTAGTTTAAGCAGAAATTTGCACCATTCACCTTTCACTTTCCGGTCCCCCAA
TCCGACCAACATTCAACGCGCTAGGATACGAAGTAAAACAAGTGACGGAACGTTTAGTCACTCAACGGCACAAGCTAATC
TTCAGGCTGCGCTGGCGGCGGCCAGTATAGACGGTCCAGTCCCTGCCAATGGCAGTGGGGAACATTTGAAGGTTGATGTC
ACAGGCGCGGGTGTTTCTTCCGGCCAGGATTCACCGCCAGTAGATCCCTTCACGCCCATAAAGTTAATAAAGAAGACATC
CGCAGGAAGTGTGAGCGCAGGAGTGACCGCAGGCGGAAGTACCACTCATGGAAGCAGCTTGAGCACACCGTTTGCGTCGT
CTTCCAGCAGTACCCATCAACGTCCGCTGCAGAAGCAACTTTCGGCAACGACGGACACCGCCTCGTTCCTGGTTCCGGCA
TCGACGTCTTCCAAAACGACCACCGCCGAAGTCCCCGGCTGCTCCGTCACGCTGGACACGATCATCACGGAGTATCTCAC
CAATCAGCATGCCTTGTGCAAACATCCGATGTCCACGTGTCCCCAATTTGATCTGTTTGTGCCACACAAGTGTCCGGATC
CACGCCCGAACAGAGCGTCCGGCATGAGCATCAACTTTGCCACACGGTTCTTCAAACGGCATGCCGGCTATTCATCGCAG
CGATTCGACCGGCGACTAGTTCATTCTAATTTTTCGGCTTCCCGTGTGTTACGACCGCAGGACTCGGACTTCTTCTTCAC
CTGTTGCGATTTCACGCCCTGCGCAACAAAACTGATCACCGGGTCGCACTCCGGAGAGGTCAAAATCTTCAACCTCAGTG
ACAGTAATGAAGAGTTTAGCTATTCGTGCCACGAGTCTTACGTAAATTCCATCATCTGTAGCAAGGATGGACGCTTGCTG
TTGACTTCCTGTGCGTGGCGGTCACCAATGTCGGCACTGTGGAACATCGAGAACAGTCGGTTCACCCAGAAGCTCACCTG
GGACGAGGAAGAGTACGTGGAGTTCCCGAACCTGAAGCAGGATAAGGTTTTGGCGACCACTGGAGAGGTCGCCACCATCT
ACGATATCAACACAGGTCAGAAGGTGCTCTCGTTGGTTCCGAGCATCTACAACCAGTACACGAAAAACCGTGCCACATTT
TGCCCGTCGGACGAGTTGATCTTGTCGGACGGTGTCCTGTGGGACGTTTCCTCCGGCAAGGAAATCCACAAGTTCGACAA
ACTGAACCAAACCATCTCCGGGGTGTTCCACCCGAACGGGCTGGAGATCGTGTCCAACACGGAGGTGTGGGACCTCCGAA
CGTTCCACCTGTTGCGAACCGTTCCGGCGCTGGACCAGTGCCACGTGAAGTTCTCTCCGCAGAATGTGATATACGGTACC
TGCCCGGAGGTAGAAACGGAACCGAACGCGGATAATGTGTGCTTTGAGTCCAGCTTTAGGGTGCTGGATGCGTACGATTA
TAGCAGCATCTCGACGGTGGACGTCAAACGGAACATCTACGATTTGGCGGTCAACCTGTACGGTAGCCAGATTGCGATCG
TGGAAAACCAGGGCGGCTACAATTCCGTGCAGGAATCCGTTGTGCGAATCTACAGCGTCGGTCGCAAGAAGAACACCGAG
GACGACGCCGAGGAAGAGGAGGAAGAGATGGAGAACAGCGAGGACAATTCGATGTCGGAAACGGAATCCGTCGTATTTCA
CGGCGCTCGCGGAGAAAACGGTGGTCAGCGTCGTCGGCGGAGACGGGGAATGCGTATCAATGTACTCGATGATGACGATG
ATATCTTTCAACCAGGTTCTTCCTCGTCGAGCGACGACGACGACGATGACGATGACAATGACGACGACGACGGCGATGAG
GACGGGGACGGCGATGGCGATGGCGATGACGACGACGGGGCCAACAACAACGACGACGAGGAGGACGCCTCATCCTGGAC
CACGACCTCCGACCTGGAGGACTTCCTCATGATGTAATAAGACAGTGAAACATTGCTAAATCCAGATGAGCGATCAGCTG
GTTCCGCCTCGCCATCCGGTGTCCAGCCGAAACGTGAGTCGTTTCCCCTCGTATCTACTTCGTTACTATCTAGAACTTGC
GTTATTTTATGGTACGTCATTGTATATAGATGTCTAGTAGGATAAAGGCCGGATTACCTTTCTCTATTAAGATCAAAAAG
CTTTAAGTTTGTTCGAGAGATTTGTTCGAAAAGTAAATTGTTTTGCAAAAAATAAATATTCAAATGGAAATCATTATTTA
TACATTTTTGAGGCATTCGTCAGAAAAAAAATCTAGCATTCGTTGTGATGGCATTTTTCGTACTGTGTAGAAAGTGTGGC
TCGCGTTTTTTACTTCTTTGAACAGACGACAGAGTTTTCCTACGTTTTCGGGTAGTTTCGTCACCTCAATTTACGGGCTT
TTATCGCGAGCAAAGAATGCTGCCGCACTGTCACAAAAACGGCGCTGAATAATCGATTTGTCCTTGTATAATATAGATTC
TAGCTCAATAAATAAATTTCATATTACGGA
PEP:
>AAEL000276-PA
MASPADQAEVLRGRDLARIFQIWEERHSVPGYDPEPVVTRLAEIFEEETEVYMRKDPDPFDERHPSRTDPNSELGRMLKT
LFRKDHFMTRLVNDYLRDNFFTRQNIQQCSQPLNIAACRLILVIMPGLETSAVFQAEFDHLITRLYGWAESSPEPLQSYA
TGLLGAAMEVQEIAVSFREQNIRLLPIMLRRLHVLQLAHRNRDRLAEAGEGMSSTAFQRMFQGEAALISKRNSTEGQSES
AMVDGAVGGEVVERPFAHLGPSEGSAVPPNGVSSASNLNTLFQNENSQNTQDAQGRQAHRNMIPIFPATIATSQMLILRY
LTPMGEYQEFLPHVFEHNAMSLIFRYIENLDAKDTCLAFEALKYLASLLCHKKFSLEFIANGGLERLLRVPRPSLAATGV
SIAFYYLAYCEDAMERICLMPQKIITELVTYALWLLGCTHDSGRCHATMFFGLSCQFKTMMDEFDKQDGLRKLYNVIAVL
PILMPADEYHLNDDEECAARQVVRHVCVALKKYFENHLYYKYNQVTRQQCPTGTLAQPVFKSVKNSPEVISDQIRTLQEL
LPMKARWSPVDEFLDLGGVNLLLRIIALAYEWNYSGRGETVRAALDVLNVCCVIPRVHAVFCERIEFPDEGSAAGINIVL
GAAEGEIVADAEVQKSALAVLVHTVCAPLHRPSGSLARFGSAKKRMPNKNSEELLQKVWESVRSNNGIIVLLSLMCVKTP
ITDADCIRGMACRAMAGLARSETVQQIIGKLSLFVNGQLQSLMRDPILQEKRAEHVQFQKYALELLERVSGKAKSANNQL
DTSLADIHKANVVAQTKIQFNEQQLLELIHQHLMARGLTETAATLVREGGITVPNPILQQHQQATSLSRNLHHSPFTFRS
PNPTNIQRARIRSKTSDGTFSHSTAQANLQAALAAASIDGPVPANGSGEHLKVDVTGAGVSSGQDSPPVDPFTPIKLIKK
TSAGSVSAGVTAGGSTTHGSSLSTPFASSSSSTHQRPLQKQLSATTDTASFLVPASTSSKTTTAEVPGCSVTLDTIITEY
LTNQHALCKHPMSTCPQFDLFVPHKCPDPRPNRASGMSINFATRFFKRHAGYSSQRFDRRLVHSNFSASRVLRPQDSDFF
FTCCDFTPCATKLITGSHSGEVKIFNLSDSNEEFSYSCHESYVNSIICSKDGRLLLTSCAWRSPMSALWNIENSRFTQKL
TWDEEEYVEFPNLKQDKVLATTGEVATIYDINTGQKVLSLVPSIYNQYTKNRATFCPSDELILSDGVLWDVSSGKEIHKF
DKLNQTISGVFHPNGLEIVSNTEVWDLRTFHLLRTVPALDQCHVKFSPQNVIYGTCPEVETEPNADNVCFESSFRVLDAY
DYSSISTVDVKRNIYDLAVNLYGSQIAIVENQGGYNSVQESVVRIYSVGRKKNTEDDAEEEEEEMENSEDNSMSETESVV
FHGARGENGGQRRRRRRGMRINVLDDDDDIFQPGSSSSSDDDDDDDDNDDDDGDEDGDGDGDGDDDDGANNNDDEEDASS
WTTTSDLEDFLMM
Swiss-ProtProtein mahjong
KEGG     K11789     
SUPERFAMILYSSF48371  ARM repeat superfamily     
Gene3DG3DSA:2.130.10.10     
SMARTSM00320     
ProSiteProfilesPS50896  LISH; LIS1 homology (LisH) motif profile.     
CoilsCoil
PANTHERPTHR13129:SF4
OrthologiGroup-00024    Protein VPRBP      

You might be interested in these researchers

You might be interested in these references