Warning! We strongly recommend Internet Explorer (9.0 and later) and Google Chrome for better display.

Gene detail [Fasta]

Species Pediculus humanus
GenePHUM083360
PositionDS235051:175094..182060[GBrowse]
VectorBasehttp://www.vectorbase.org/search/site/PHUM083360
Gene Expressionhttps://www.vectorbase.org/expression-browser/gene/PHUM083360
sequence mRNA:
>PHUM083360-RA
ATGAGTGAACAGCCAGTGCCCTTAAAAAATTTGACTGATGTCAGTCAAATACTCAGAAAATGGGAAGATGAGCATAATGA
ACCTGAGTATGATCCTATTCCAATTTTAACAAGGCTAGCTGAAATTGTTGAAACTGAAATGGAAGCCTACATGAAAATGG
ATCCGGATCCGTTTGATGAAAGACATCCTTCCAGAGCAGATCCTAATTGTAATTTAGGGCATGTTTTAAAAGTGATATTT
AAAAAAGATGCATTTATGAATAAGTTGGTGAACGATTATCTCAGAGATAATTATTGGAGTAGGCTCGGAAATACAGACAA
AGATGACAGACAATTAAATATTGCTGCCTGTCGTTTGGTTTTAGATGTTATGCCTGGATTAGAAACATCAGCAGTATTTC
AAACACCAGATACTGACTCACTTATTTTAAGGCTTTTTAATTGGGCTGAAAAAGCTATTGAACCACTTCAAAGTTATGCT
GTGGGACTTTTATCTGCAGCTATGGAAGTTCAAGACACTGCTGCAGCTTTCAGGGAGCAAAATGCTCATTTAGTACCTAT
CATGTTAAAAAGATTGCATAGACTACAAGAAAAAGCAGCAATGGAAAGGCAGCAGGCTGCCATGTCTACTTCTAGGCCGT
TTGCACATCTGAATCATGAAAATACATGTGCTAAAAAAATTTCTAGTAATAGGAATAGTGGAGGAAATTCTCCTCGTTTA
ACGTCACCTCCATTAATGAGTCCTCCTCCGACAGATTTGCAAATCCATGATAAAACACCTGTCAAAATTAATGGAGTTGT
CACAAAGACCAAAAGAGATTCCTTTAATGGAGAAGGTGATAAAATGGATATCGATTCCACACCACAAAAAAATCACGGAA
ATGCACGACAATCTACTCCTTCAGGAAGTGTCATAACATCAGCTGCGAGTGAATGTTCAAACTCATCCTGGGCTGAAATG
GAATCTTTTGTTATAGCCAACGTTTCCATACATCCTTTAACCCTTGCTACTAGACAAATGCTGACTTTAAGATACTTAAC
ACCAATGGGAGAATATCAAGAGTTTTTGAGTCACATATTTGAACACAACGCTTTGTCGTTAATTTTAAAATACACTAATA
TTCGAGAAACCAAAGAAACGCGATTAGGTTTTGAATCGTTAAAGTATTTGGCTGCTCTTCTTTGTCATAAAAAAGTTTCA
ATAGAATTTATTAACATGGGAGGATTAATAAGTTTGCTGGAAGTTCCGAGACCGAGTGTTGCTGCAACTGGAGTGTCAAT
CTGCTTGTATTATTTGTCCTATTGTGAGGATGCCATGGAAAGAGTTTGCCTTTTACCCCAATATGTAGTTTCTGATTTGG
TCAGCTACGCATTATGGTTATTGGAAAGATCGCATAATTCGGGAAGATGTCACGCGACCATGTTTTTCGGTTTATCTTTT
CAATTTAGAGTTATTTTAGAAGAATTTGACGCTCAAGATGGTTTACGAAAATTGTACAATGTGATCAGTACATTGCCTAT
ATTATCTGTAGAAGATGAAGTTTCATCGGTTTTAAACGAAGATGAAGAATGTTCCTACAGGCAAATTGTTCGCCATGTTA
CGGTTGCATTGAAAAGATATTACGAAGCTCATTTATATATAAAAGCGGAACAATTAAGAAGGGCGCAAGATAGAGATTGT
GGTGAAAAAAATTTTCGTACAACATTACCTTCGTACAAAGCGTGCCGAGGTTCTCCGGAAGAAGTTCAAGCTCAAATTGA
AACCCTTTTAGAATTAATGCCTTTTAATGCACCCTGGCCTTGCGTTGACGAACTTTTGCGTTTGGGTGGAATAACATTAC
TTCTTCAAATAATTGCTTTTACTTACGACTGGAATTTCAGCGGGAGGGCTGAAACCGTGCATAGCGCTTTAAACGTTCTT
GCTATTTGCGCCGTTCGCCCAAAAGTTCAATTAGTTTTCTGTGATCGTTTAGAACTCCCTGATGAAGCTATGACAATTGG
AATGAATATAATATTAGGAGCTAGCGAAGGAGAAATCGTGGCCGATCCTGACGTTCAAAAAGCCGCTTTACAAGTTATTA
TCAATTGCGTTTGTGCACCGATACATAGGGTGGGAGTGTGTTTGGGAAGATATTCGGCTAATGGTTCGGCTATAAAGAAA
AAAACTTGTCGTTCAAGCGAAGAACTTATACAGAAAATGTGGGAGAGTGTTAGAGAAAATAATGGGATTATTGTTTTACT
TATGCTAATGATGATCAAAACTCCCATCACAGATGCGGATTCCATTCGTGCTTTAGCTTGTAGAGCTCTTGCCGGTTTGG
CTAGATGTGAAAAAGTTAGACAAATTGTTAGCAAACTGCCCGTTTTAAGCAATGGATCGATGCAAGTTCTTCTTAGGGAT
CCGATTCTTCAAGAGAAAAGACAAGAACACGTTCAATTTCAAAAATATTATTTAGAATTAATTGAACACATAACGGGAAA
AAATCAACCGACTGCAAGCGATGATATTTCTCTACCCAACATCCACAGAGCGAACGTCGTTGCTCAAACCCGCATACAAT
ACAACAAAAATCAACTTTATCAACTGATGTACGAGCAATTGATTCAAGATGGTTTGCAAGAAGCAGCAAACGCTTTGCAA
AAAGAAGCCAACATTAGTCCTCCTCCGAAGCAACAATTAGCGATTCATCATAAATCGAGTCCCGTGCCCATCAGGCCTCG
TAATAATGTGTTCACGCCGCGTGCTTTAACATTTTGCAATCATGCAACACCTCCAGCTTCTAACAACACATCAACAACAG
CAACGCCTACAACTTCCAATTCCGTCATTTCCAGTTATTCAGTTGTCAATACTTCTCCACATATAAAATTAAATTTAGCT
AATTCAAGAAAAGATAAAATGTCTCCAAGTGTACCTTCTTCATACGGTTTAAATCGGTCGTTACAAAAACAAACAAGTTG
GGATTCATCTCAACTCGCGGCTATGGTCACGCCTACGTTACACATGAAAACTCCTCAAACGATTGCAAATTCTTATTGTC
ACAGCGATAGAATAACTTTGGATTCAATAGTTACTGAATATTTAACGAATCAACATGCACTCTGTAAAAATCCAATGGTT
ACTTGTCCACAGTTTAATTTATTTGTACCTCATAGATGTCCAGATCCGAAATCTAGAAATTCCACTCCGAATAATTTTAC
AACGCGTTTTATAAAACGTCAAACCGGATATAAAGTTAGCAATAAAATGGATAATCGATTAGGTCACTCTAGGTTTTGTC
CCGTTCGAACGTTTAGATTAAACGACGAAGGTGGATTTTTTACCTGTTGCGAATTTCTACCTTGCGGAAGACTCATTGCA
ATGGGAACTTATCAAGGAGAAGTTTGGCTTTATAACCTTCACACGGGAGCGGAAGAGGTTTCCGAACAATGTCACGATTC
TTATTTGTATAATATTCAAACTAATAGAAAGGGTGATTTAATGTTGACATCATCAACTTGGAGAAGACCCTTATCAGCAC
TTTGGGGAATAAGTTCGGTGTTTGTTATGAAGCAACCCCTTCAAGAAGAAGAATATGCAGAATTCAGTAAAGTGAATCAG
GACAGGATAGTGGGAACAAAAGCATCGACAGCAACGATATACGACGTTGAAACGGGAGTGAGCATATTAACTCTGTCTCC
GAGGCTTTCAAACACGTATTCGAAAAATAGAGCCACGTATAATCCGACGGACGAACTCATATTGACCGATGGAGTTTTGT
TCGATGTTAATTCGGGAAAAGAAATTCACAAATTCGACAAATTAAATCCGGTTTTATCGGGTGTGTTTCATCCGAACGGT
TTAGAGATAGTGTCAAATACCGAAATATGGGATCTGAGAACGTTTCACTTACTGCGAACGGTCGCGGCATTGGATCATCA
ACACGTTTTGTTTTCGACACCCGAAAGTGCTCTTTACACGTATAGTTTCGAGCAGGAAAACGATGAGGATACAACGTTCG
AATCGTCATTTAAAACATTAGATTCTAGTGATTATTCAAGTATAGCTACCATTGAAGTGAAGAAAAACGTTTATCACATG
GCATGTAACAAATGGGATACGCAAATTGCTGTCGTTGAAAACGTTGGAGAATTTCACACGGTTCAAGAATCATCCGTCCG
ATTATACGACGTTGGAAGAATACGAGATACCGAAGACGATGCCGAAGAAGAAGAGGAAGAAGATGACATGGACGGAAGCG
AAGAAGGTTCAAATTCTCAAAGCGGTTCCGATAACGATGACAATACGGAAAATGATAATAACGGAGATAATAACGGAGAC
GAGGGTAATTTGGAAGATCTCTTGAACGAGGGGAGGTGA
PEP:
>PHUM083360-PA
MSEQPVPLKNLTDVSQILRKWEDEHNEPEYDPIPILTRLAEIVETEMEAYMKMDPDPFDERHPSRADPNCNLGHVLKVIF
KKDAFMNKLVNDYLRDNYWSRLGNTDKDDRQLNIAACRLVLDVMPGLETSAVFQTPDTDSLILRLFNWAEKAIEPLQSYA
VGLLSAAMEVQDTAAAFREQNAHLVPIMLKRLHRLQEKAAMERQQAAMSTSRPFAHLNHENTCAKKISSNRNSGGNSPRL
TSPPLMSPPPTDLQIHDKTPVKINGVVTKTKRDSFNGEGDKMDIDSTPQKNHGNARQSTPSGSVITSAASECSNSSWAEM
ESFVIANVSIHPLTLATRQMLTLRYLTPMGEYQEFLSHIFEHNALSLILKYTNIRETKETRLGFESLKYLAALLCHKKVS
IEFINMGGLISLLEVPRPSVAATGVSICLYYLSYCEDAMERVCLLPQYVVSDLVSYALWLLERSHNSGRCHATMFFGLSF
QFRVILEEFDAQDGLRKLYNVISTLPILSVEDEVSSVLNEDEECSYRQIVRHVTVALKRYYEAHLYIKAEQLRRAQDRDC
GEKNFRTTLPSYKACRGSPEEVQAQIETLLELMPFNAPWPCVDELLRLGGITLLLQIIAFTYDWNFSGRAETVHSALNVL
AICAVRPKVQLVFCDRLELPDEAMTIGMNIILGASEGEIVADPDVQKAALQVIINCVCAPIHRVGVCLGRYSANGSAIKK
KTCRSSEELIQKMWESVRENNGIIVLLMLMMIKTPITDADSIRALACRALAGLARCEKVRQIVSKLPVLSNGSMQVLLRD
PILQEKRQEHVQFQKYYLELIEHITGKNQPTASDDISLPNIHRANVVAQTRIQYNKNQLYQLMYEQLIQDGLQEAANALQ
KEANISPPPKQQLAIHHKSSPVPIRPRNNVFTPRALTFCNHATPPASNNTSTTATPTTSNSVISSYSVVNTSPHIKLNLA
NSRKDKMSPSVPSSYGLNRSLQKQTSWDSSQLAAMVTPTLHMKTPQTIANSYCHSDRITLDSIVTEYLTNQHALCKNPMV
TCPQFNLFVPHRCPDPKSRNSTPNNFTTRFIKRQTGYKVSNKMDNRLGHSRFCPVRTFRLNDEGGFFTCCEFLPCGRLIA
MGTYQGEVWLYNLHTGAEEVSEQCHDSYLYNIQTNRKGDLMLTSSTWRRPLSALWGISSVFVMKQPLQEEEYAEFSKVNQ
DRIVGTKASTATIYDVETGVSILTLSPRLSNTYSKNRATYNPTDELILTDGVLFDVNSGKEIHKFDKLNPVLSGVFHPNG
LEIVSNTEIWDLRTFHLLRTVAALDHQHVLFSTPESALYTYSFEQENDEDTTFESSFKTLDSSDYSSIATIEVKKNVYHM
ACNKWDTQIAVVENVGEFHTVQESSVRLYDVGRIRDTEDDAEEEEEEDDMDGSEEGSNSQSGSDNDDNTENDNNGDNNGD
EGNLEDLLNEGR
Swiss-ProtProtein mahjong
KEGG     K11789     
SUPERFAMILYSSF50978  WD40 repeat-like superfamily     
Gene3DG3DSA:1.25.10.10     
ProSiteProfilesPS50896  LISH; LIS1 homology (LisH) motif profile.     
PANTHERPTHR13129
OrthologiGroup-00024    Protein VPRBP      

You might be interested in these researchers

You might be interested in these references