Gene detail [Fasta]
| Species | Drosophila virilis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002056413.1 |
| sequence |
PEP: >XP_002056413.1 MQTKDRLRREYNSYNDLSREFRMYDEQSMDSLLDDRLRIHMNPNGSDELSLQRDDFYASAYPQSPQLLLRQHNFKLKVYY |
| Swiss-Prot | GTPase-activating protein RacGAP84C |
| KEGG | K16733 |
| SUPERFAMILY | SSF57889 Cysteine-rich domain superfamily |
| Gene3D | G3DSA:3.30.60.20 |
| Pfam | PF00130 C1_1; Phorbol esters/diacylglycerol binding domain (C1 domain) |
| SMART | SM00109 |
| ProSiteProfiles | PS50081 ZF_DAG_PE_2; Zinc finger phorbol-ester/DAG-type profile. |
| ProSitePatterns | PS00479 ZF_DAG_PE_1; Zinc finger phorbol-ester/DAG-type signature. |
| PANTHER | PTHR23174 |
You might be interested in these researchers
You might be interested in these references
