Gene detail [Fasta]
| Species | Drosophila virilis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002056340.1 |
| sequence |
PEP: >XP_002056340.1 MGYRPPNDWTSQFRLQRPAPTIQIGEEKFVLRLDTIFVLGMRLNVTKNDIIIFFGKLGRIKMDELTMKPKIFVYKNKLTG |
| Swiss-Prot | RNA-binding protein cabeza |
| SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
| Gene3D | G3DSA:3.30.70.330 |
| Pfam | PF14259 RRM_6; RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) |
| SMART | SM00547 |
| ProSiteProfiles | PS50199 ZF_RANBP2_2; Zinc finger RanBP2 type profile. |
| ProSitePatterns | PS01358 ZF_RANBP2_1; Zinc finger RanBP2-type signature. |
| PANTHER | PTHR23238 |
You might be interested in these researchers
You might be interested in these references
