Gene detail [Fasta]
Species | Drosophila virilis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002054871.1 |
sequence |
PEP: >XP_002054871.1 MSTLELCEKYFETRDVYKLMGIAKDAKEKEIKKAYHKLSLLVHPDRVPDAQKDESTEKFKVLSKIYQVLTDTQKRALFDE |
Swiss-Prot | J domain-containing protein CG6693 |
KEGG | K09529 |
SUPERFAMILY | SSF46565 Chaperone J-domain superfamily |
Gene3D | G3DSA:1.10.287.110 |
Pfam | PF00226 DnaJ; DnaJ domain |
SMART | SM00271 |
ProSiteProfiles | PS50076 DNAJ_2; dnaJ domain profile. |
PRINTS | PR00625 |
ProSitePatterns | PS00636 DNAJ_1; Nt-dnaJ domain signature. |
PANTHER | PTHR24078:SF166 |
You might be interested in these researchers

You might be interested in these references
