Gene detail [Fasta]
| Species | Drosophila virilis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002052965.1 |
| sequence |
PEP: >XP_002052965.1 MLRKQARQRREFLYNKSINERVLTKKKNMKIINENLKDKTSFGSSNILDGINMYNSLKYYPDIEGETLSHIDEYKYAGCQ |
| Swiss-Prot | Brix domain-containing protein ZK795.3 |
| KEGG | K14561 IMP4; U3 small nucleolar ribonucleoprotein protein IMP4 |
| SUPERFAMILY | SSF52954 Class II aaRS ABD-related superfamily |
| Gene3D | G3DSA:3.40.50.10480 |
| Pfam | PF04427 Brix; Brix domain |
| SMART | SM00879 |
| ProSiteProfiles | PS50833 BRIX; Brix domain profile. |
| PANTHER | PTHR22734 |
You might be interested in these researchers
You might be interested in these references
