Gene detail [Fasta]
| Species | Drosophila virilis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002052521.1 |
| sequence |
PEP: >XP_002052521.1 MKFAAVICLLFALFGVSLALKDSICGLPPAADGNGLIKCAAFMPSWSYYPEENACKKFIYGGCGGNDNRFGTEELCASKC |
| Swiss-Prot | Male accessory gland serine protease inhibitor |
| SUPERFAMILY | SSF57362 BPTI-like superfamily |
| Gene3D | G3DSA:4.10.410.10 |
| Pfam | PF00014 Kunitz_BPTI; Kunitz/Bovine pancreatic trypsin inhibitor domain |
| SMART | SM00131 |
| ProSiteProfiles | PS50279 BPTI_KUNITZ_2; Pancreatic trypsin inhibitor (Kunitz) family profile. |
| PRINTS | PR00759 |
| ProSitePatterns | PS00280 BPTI_KUNITZ_1; Pancreatic trypsin inhibitor (Kunitz) family signature. |
| PANTHER | PTHR10083 |
You might be interested in these researchers
You might be interested in these references
