Gene detail [Fasta]
Species | Drosophila virilis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002051586.1 |
sequence |
PEP: >XP_002051586.1 MKYFAVLLLLCTLLGAALATLKNPACGEEFGKIGNCRAQKSKWTYRRDTNECINFTYGGCQGNNNLFDTKNLCEQTCKV |
Swiss-Prot | Male accessory gland serine protease inhibitor |
SUPERFAMILY | SSF57362 BPTI-like superfamily |
Gene3D | G3DSA:4.10.410.10 |
Pfam | PF00014 Kunitz_BPTI; Kunitz/Bovine pancreatic trypsin inhibitor domain |
SMART | SM00131 |
ProSiteProfiles | PS50279 BPTI_KUNITZ_2; Pancreatic trypsin inhibitor (Kunitz) family profile. |
PRINTS | PR00759 |
ProSitePatterns | PS00280 BPTI_KUNITZ_1; Pancreatic trypsin inhibitor (Kunitz) family signature. |
You might be interested in these researchers

You might be interested in these references
