Gene detail [Fasta]
Species | Drosophila virilis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002049324.1 |
sequence |
PEP: >XP_002049324.1 MSFSRSSLRYAHTNGYTGLLYTPKGDFIITCGTDGDIRHWTCISDDDPRSTCLGEFVMSIAHTGSRLLASTDRNTVHAYT |
Swiss-Prot | WD repeat and HMG-box DNA-binding protein 1 |
KEGG | K11274 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF12341 Mcl1_mid; Minichromosome loss protein, Mcl1, middle region |
SMART | SM00320 |
ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
PANTHER | PTHR19932:SF10 |
You might be interested in these researchers

You might be interested in these references
