Gene detail [Fasta]
Species | Drosophila virilis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002048309.1 |
sequence |
PEP: >XP_002048309.1 MSDVQTLMDMGFPRDRVEYALSVTSHKGVEIAMEWLLAHGDEEIPTAAADPAATEDSAPSSSGAADVSGGAAVAKSLKCD |
Swiss-Prot | UBX domain-containing protein 1 |
SUPERFAMILY | SSF46934 UBA-like superfamily |
Gene3D | G3DSA:3.10.20.90 |
Pfam | PF00789 UBX; UBX domain |
SMART | SM00166 |
ProSiteProfiles | PS50033 UBX; UBX domain profile. |
Coils | Coil |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
PANTHER | PTHR13020:SF25 |
You might be interested in these researchers

You might be interested in these references
